PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 165aa    MW: 19011.4 Da    PI: 9.3217
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06397.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-3944102260
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k 
  KHN06397.1  44 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKVKP 102
                 68999***************************************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3043101IPR003851Zinc finger, Dof-type
PfamPF027016.3E-3246101IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.11848102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MAEAQSGQAS EGIKLFGTTI TLHGRERKED RNDSEDGTEE IKRPDKIIPC PRCKSMETKF  60
CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKV KPQFGQEERL ALDEWHVAAV  120
AHGDFRQLFP SKRRRMSSAQ HESQRKFVII HEITEHPNQI ETKEA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0926790.0BT092679.1 Soybean clone JCVI-FLGm-11D11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237635.11e-123uncharacterized protein LOC100527802
SwissprotP683501e-52DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A0B2PFQ21e-123A0A0B2PFQ2_GLYSO; Dof zinc finger protein DOF1.5
TrEMBLC6T5G71e-123C6T5G7_SOYBN; Uncharacterized protein
STRINGGLYMA05G29090.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64833251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.16e-54Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]